SCOPe 2.08: Domain d1mmoh_: 1mmo H:

Lineage for d1mmoh_ (1mmo H:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family)
   duplication: consists of two domains of this fold
   automatically mapped to Pfam PF02964

5. Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (2 proteins)

6. Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [47155] (27 PDB entries)

8. Domain d1mmoh_: 1mmo H: [16513]
   Other proteins in same PDB: d1mmob_, d1mmoc_, d1mmod_, d1mmoe_
   complexed with acy, fe

Details for d1mmoh_

PDB Entry: 1mmo, 2.2 Å

PDB Description: crystal structure of a bacterial non-haem iron hydroxylase that catalyses the biological oxidation of methane

PDB Compounds: (H:) methane monooxygenase hydrolase (gamma chain)

SCOPe Domain Sequences for d1mmoh_:

Sequence; same for both SEQRES and ATOM records:

>d1mmoh_ a.23.3.1 (H:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
lgihsndtrdawvnkiahvntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvh

Timeline for d1mmoh_:

• d1mmoh_ first appeared (with stable ids) in SCOP 1.55
  
• d1mmoh_ appears in SCOPe 2.07