Lineage for d1mmog_ (1mmo G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699273Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 2699320Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
    automatically mapped to Pfam PF02964
  5. 2699321Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (2 proteins)
  6. 2699322Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 2699323Species Methylococcus capsulatus [TaxId:414] [47155] (27 PDB entries)
  8. 2699370Domain d1mmog_: 1mmo G: [16512]
    Other proteins in same PDB: d1mmob_, d1mmoc_, d1mmod_, d1mmoe_
    complexed with acy, fe

Details for d1mmog_

PDB Entry: 1mmo (more details), 2.2 Å

PDB Description: crystal structure of a bacterial non-haem iron hydroxylase that catalyses the biological oxidation of methane
PDB Compounds: (G:) methane monooxygenase hydrolase (gamma chain)

SCOPe Domain Sequences for d1mmog_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmog_ a.23.3.1 (G:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
lgihsndtrdawvnkiahvntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvh

SCOPe Domain Coordinates for d1mmog_:

Click to download the PDB-style file with coordinates for d1mmog_.
(The format of our PDB-style files is described here.)

Timeline for d1mmog_: