Lineage for d2heja_ (2hej A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829136Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2829137Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2829537Protein automated matches [190169] (7 species)
    not a true protein
  7. 2829619Species Mouse (Mus musculus) [TaxId:10090] [187524] (12 PDB entries)
  8. 2829620Domain d2heja_: 2hej A: [165072]
    automated match to d1mrqa_
    complexed with bme, edo, mpd, ndp

Details for d2heja_

PDB Entry: 2hej (more details), 1.35 Å

PDB Description: Crystal structure of 17alpha-hydroxysteroid dehydrogenase in complex with NADP(H) in a closed conformation
PDB Compounds: (A:) Aldo-keto reductase family 1, member C21

SCOPe Domain Sequences for d2heja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2heja_ c.1.7.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hcvilndgnfipvlgfgtalplecpkskakeltkiaidagfhhfdsasvyntedhvgeai
rskiadgtvrredifytskvwctslhpelvraslerslqklqfdyvdlylihypmalkpg
eenfpvdehgklifdrvdlcatweamekckdagltksigvsnfnyrqlemilnkpglkyk
pvcnqvechpylnqmklldfckskdivlvaygvlgtqryggwvdqnspvlldepvlgsma
kkynrtpalialryqlqrgivvlntslkeerikenmqvfefqlssedmkvldglnrnmry
ipaaifkghpnwpfldey

SCOPe Domain Coordinates for d2heja_:

Click to download the PDB-style file with coordinates for d2heja_.
(The format of our PDB-style files is described here.)

Timeline for d2heja_: