SCOP 1.63: Domain d1fz0e_: 1fz0 E:

Lineage for d1fz0e_ (1fz0 E:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (5 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family)
   duplication: consists of two domains of this fold

5. Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)

6. Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [47155] (15 PDB entries)

8. Domain d1fz0e_: 1fz0 E: [16506]
   Other proteins in same PDB: d1fz0a_, d1fz0b_, d1fz0c_, d1fz0d_

Details for d1fz0e_

PDB Entry: 1fz0, 2.07 Å

PDB Description: methane monooxygenase hydroxylase, form ii mixed-valent grown anaerobically

SCOP Domain Sequences for d1fz0e_:

Sequence; same for both SEQRES and ATOM records:

>d1fz0e_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsp

Timeline for d1fz0e_:

• d1fz0e_ first appeared (with stable ids) in SCOP 1.55
  
• d1fz0e_ appears in SCOP 1.61
  
• d1fz0e_ appears in SCOP 1.65
  
• d1fz0e_ appears in the current release, SCOPe 2.08