Class a: All alpha proteins [46456] (171 folds) |
Fold a.23: Open three-helical up-and-down bundle [47143] (5 superfamilies) core: 3 helices; bundle, open |
Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) duplication: consists of two domains of this fold |
Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein) |
Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species) |
Species Methylococcus capsulatus [TaxId:414] [47155] (15 PDB entries) |
Domain d1fz0e_: 1fz0 E: [16506] Other proteins in same PDB: d1fz0a_, d1fz0b_, d1fz0c_, d1fz0d_ |
PDB Entry: 1fz0 (more details), 2.07 Å
SCOP Domain Sequences for d1fz0e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fz0e_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus} klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsp
Timeline for d1fz0e_: