SCOP 1.63: Domain d1fz7e_: 1fz7 E:

Lineage for d1fz7e_ (1fz7 E:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (5 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family)
   duplication: consists of two domains of this fold

5. Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)

6. Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [47155] (15 PDB entries)

8. Domain d1fz7e_: 1fz7 E: [16504]
   Other proteins in same PDB: d1fz7a_, d1fz7b_, d1fz7c_, d1fz7d_

Details for d1fz7e_

PDB Entry: 1fz7, 1.96 Å

PDB Description: methane monooxygenase hydroxylase, form iii soaked in 0.9 m ethanol

SCOP Domain Sequences for d1fz7e_:

Sequence; same for both SEQRES and ATOM records:

>d1fz7e_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs

Timeline for d1fz7e_:

• d1fz7e_ first appeared (with stable ids) in SCOP 1.55
  
• d1fz7e_ appears in SCOP 1.61
  
• d1fz7e_ appears in SCOP 1.65
  
• d1fz7e_ appears in the current release, SCOPe 2.08