SCOP 1.71: Domain d1fz1f_: 1fz1 F:

Lineage for d1fz1f_ (1fz1 F:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (5 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family)
   duplication: consists of two domains of this fold

5. Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)

6. Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [47155] (15 PDB entries)

8. Domain d1fz1f_: 1fz1 F: [16501]
   Other proteins in same PDB: d1fz1a_, d1fz1b_, d1fz1c_, d1fz1d_
   complexed with ca, fe, fmt

Details for d1fz1f_

PDB Entry: 1fz1, 1.96 Å

PDB Description: methane monooxygenase hydroxylase, form iii oxidized

SCOP Domain Sequences for d1fz1f_:

Sequence; same for both SEQRES and ATOM records:

>d1fz1f_ a.23.3.1 (F:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsph

Timeline for d1fz1f_:

• d1fz1f_ first appeared (with stable ids) in SCOP 1.55
  
• d1fz1f_ appears in SCOP 1.69
  
• d1fz1f_ appears in SCOP 1.73
  
• d1fz1f_ appears in the current release, SCOPe 2.08