SCOPe 2.01: Domain d2h8ib_: 2h8i B:

Lineage for d2h8ib_ (2h8i B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)

6. Protein automated matches [190139] (19 species)
   not a true protein

7. Species Jararacussu (Bothrops jararacussu) [TaxId:8726] [186913] (7 PDB entries)

8. Domain d2h8ib_: 2h8i B: [165009]
   automated match to d1pa0a_
   complexed with peg

Details for d2h8ib_

PDB Entry: 2h8i, 1.9 Å

PDB Description: crystal structure of the bothropstoxin-i complexed with polyethylene glycol

PDB Compounds: (B:) Phospholipase A2 homolog 1

SCOPe Domain Sequences for d2h8ib_:

Sequence; same for both SEQRES and ATOM records:

>d2h8ib_ a.133.1.2 (B:) automated matches {Jararacussu (Bothrops jararacussu) [TaxId: 8726]}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
c

Timeline for d2h8ib_:

• d2h8ib_ is new in SCOPe 2.01-stable
  
• d2h8ib_ appears in SCOPe 2.02
  
• d2h8ib_ appears in the current release, SCOPe 2.08