SCOPe 2.06: Domain d2h79a1: 2h79 A:148-408

Lineage for d2h79a1 (2h79 A:148-408)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein automated matches [190059] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)

8. Domain d2h79a1: 2h79 A:148-408 [165003]
   Other proteins in same PDB: d2h79a2
   automated match to d1nava_
   complexed with t3

Details for d2h79a1

PDB Entry: 2h79, 1.87 Å

PDB Description: crystal structure of human tr alpha bound t3 in orthorhombic space group

PDB Compounds: (A:) THRA protein

SCOPe Domain Sequences for d2h79a1:

Sequence; same for both SEQRES and ATOM records:

>d2h79a1 a.123.1.1 (A:148-408) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eemirslqqrpeptpeewdlihiateahrstnaqgshwkqrrkflpddigqspivsmpdg
dkvdleafseftkiitpaitrvvdfakklpmfselpcedqiillkgccmeimslraavry
dpesdtltlsgemavkreqlkngglgvvsdaifelgkslsafnlddtevallqavllmst
drsgllcvdkieksqeayllafehyvnhrkhniphfwpkllmkvtdlrmigachasrflh
ckvecptelfpplflevfedq

Timeline for d2h79a1:

• d2h79a1 first appeared in SCOPe 2.01, called d2h79a_
  
• d2h79a1 was called d2h79a_ in SCOPe 2.05
  
• d2h79a1 appears in SCOPe 2.07
  
• d2h79a1 appears in the current release, SCOPe 2.08