SCOPe 2.01: Domain d2h79a_: 2h79 A:

Lineage for d2h79a_ (2h79 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein automated matches [190059] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187214] (97 PDB entries)

8. Domain d2h79a_: 2h79 A: [165003]
   automated match to d1nava_
   complexed with t3

Details for d2h79a_

PDB Entry: 2h79, 1.87 Å

PDB Description: crystal structure of human tr alpha bound t3 in orthorhombic space group

PDB Compounds: (A:) THRA protein

SCOPe Domain Sequences for d2h79a_:

Sequence; same for both SEQRES and ATOM records:

>d2h79a_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
argshmeemirslqqrpeptpeewdlihiateahrstnaqgshwkqrrkflpddigqspi
vsmpdgdkvdleafseftkiitpaitrvvdfakklpmfselpcedqiillkgccmeimsl
raavrydpesdtltlsgemavkreqlkngglgvvsdaifelgkslsafnlddtevallqa
vllmstdrsgllcvdkieksqeayllafehyvnhrkhniphfwpkllmkvtdlrmigach
asrflhckvecptelfpplflevfedq

Timeline for d2h79a_:

• d2h79a_ is new in SCOPe 2.01-stable
  
• d2h79a_ appears in SCOPe 2.02
  
• d2h79a_ appears in the current release, SCOPe 2.08, called d2h79a1