SCOP 1.75: Domain d1fz1e_: 1fz1 E:

Lineage for d1fz1e_ (1fz1 E:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family)
   duplication: consists of two domains of this fold

5. Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)

6. Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [47155] (26 PDB entries)

8. Domain d1fz1e_: 1fz1 E: [16500]
   Other proteins in same PDB: d1fz1a_, d1fz1b_, d1fz1c_, d1fz1d_

Details for d1fz1e_

PDB Entry: 1fz1, 1.96 Å

PDB Description: methane monooxygenase hydroxylase, form iii oxidized

PDB Compounds: (E:) methane monooxygenase component a, gamma chain

SCOP Domain Sequences for d1fz1e_:

Sequence; same for both SEQRES and ATOM records:

>d1fz1e_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs

Timeline for d1fz1e_:

• d1fz1e_ first appeared (with stable ids) in SCOP 1.55
  
• d1fz1e_ appears in SCOP 1.73
  
• d1fz1e_ appears in SCOPe 2.01
  
• d1fz1e_ appears in the current release, SCOPe 2.07