Lineage for d1fz1e_ (1fz1 E:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.23: Open three-helical up-and-down bundle [47143] (4 superfamilies) 
Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) 
Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein) Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species) Species Methylococcus capsulatus [TaxId:414] [47155] (10 PDB entries) 
Domain d1fz1e_: 1fz1 E: [16500]
Other proteins in same PDB: d1fz1a_, d1fz1b_, d1fz1c_, d1fz1d_
Details for d1fz1e_
PDB Entry: 1fz1 (more details), 1.96 Å
PDB Description: methane monooxygenase hydroxylase, form iii oxidized
SCOP Domain Sequences for d1fz1e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fz1e_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs
SCOP Domain Coordinates for d1fz1e_:
Click to download the PDB-style file with coordinates for d1fz1e_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fz1e_:
- d1fz1e_ appears in SCOP 1.57
- d1fz1e_ appears in the current release, SCOPe 2.08
View in 3D
