SCOPe 2.06: Domain d2h74b_: 2h74 B:

Lineage for d2h74b_ (2h74 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (16 species)

7. Species Escherichia coli [TaxId:562] [52836] (47 PDB entries)
   Uniprot P00274 ! Uniprot P00581

8. Domain d2h74b_: 2h74 B: [164997]
   automated match to d1xoaa_
   complexed with mpd; mutant

Details for d2h74b_

PDB Entry: 2h74, 2.4 Å

PDB Description: crystal structure of thioredoxin mutant d2e in hexagonal (p61) space group

PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d2h74b_:

Sequence; same for both SEQRES and ATOM records:

>d2h74b_ c.47.1.1 (B:) Thioredoxin {Escherichia coli [TaxId: 562]}
sekiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla

Timeline for d2h74b_:

• d2h74b_ first appeared in SCOPe 2.01
  
• d2h74b_ appears in SCOPe 2.05
  
• d2h74b_ appears in SCOPe 2.07
  
• d2h74b_ appears in the current release, SCOPe 2.08