Class a: All alpha proteins [46456] (290 folds) |
Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies) core: 3 helices; bundle, open |
Superfamily a.23.2: Diol dehydratase, gamma subunit [47148] (1 family) contains irregular N-terminal subdomain automatically mapped to Pfam PF02287 |
Family a.23.2.1: Diol dehydratase, gamma subunit [47149] (2 proteins) |
Protein Diol dehydratase, gamma subunit [47150] (2 species) |
Species Klebsiella oxytoca [TaxId:571] [47151] (8 PDB entries) |
Domain d1egmm_: 1egm M: [16495] Other proteins in same PDB: d1egma_, d1egmb_, d1egme_, d1egml_ complexed with cnc, k, pgo |
PDB Entry: 1egm (more details), 1.85 Å
SCOPe Domain Sequences for d1egmm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1egmm_ a.23.2.1 (M:) Diol dehydratase, gamma subunit {Klebsiella oxytoca [TaxId: 571]} sarvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakda grdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafv reaatlyverkklkgdd
Timeline for d1egmm_: