SCOPe 2.01: Domain d2h4cg_: 2h4c G:

Lineage for d2h4cg_ (2h4c G:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)

6. Protein automated matches [190139] (19 species)
   not a true protein

7. Species Daboia russellii [TaxId:343250] [187787] (1 PDB entry)

8. Domain d2h4cg_: 2h4c G: [164942]
   automated match to d1oqsa_

Details for d2h4cg_

PDB Entry: 2h4c, 2.6 Å

PDB Description: Structure of Daboiatoxin (heterodimeric PLA2 venom)

PDB Compounds: (G:) Phospholipase A2-III

SCOPe Domain Sequences for d2h4cg_:

Sequence; same for both SEQRES and ATOM records:

>d2h4cg_ a.133.1.2 (G:) automated matches {Daboia russellii [TaxId: 343250]}
nffqfaemivkmtgkeavhsyaiygcycgwggqgkpqdatdrccfvhdccygtvndcnpk
matysysfengdivcgdnnlclktvcecdraaaiclgqnvntydknyenyaishcteese
qc

Timeline for d2h4cg_:

• d2h4cg_ is new in SCOPe 2.01-stable
  
• d2h4cg_ appears in SCOPe 2.02
  
• d2h4cg_ appears in the current release, SCOPe 2.08