Lineage for d2h1kb_ (2h1k B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1720411Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1721270Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 1721271Protein automated matches [190674] (16 species)
    not a true protein
  7. 1721303Species Golden hamster (Mesocricetus auratus) [TaxId:10036] [187780] (1 PDB entry)
  8. 1721305Domain d2h1kb_: 2h1k B: [164913]
    automated match to d1ahdp_
    protein/DNA complex

Details for d2h1kb_

PDB Entry: 2h1k (more details), 2.42 Å

PDB Description: Crystal structure of the Pdx1 homeodomain in complex with DNA
PDB Compounds: (B:) Pancreatic and duodenal homeobox 1

SCOPe Domain Sequences for d2h1kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h1kb_ a.4.1.0 (B:) automated matches {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}
nkrtrtaytraqllelekeflfnkyisrprrvelavmlnlterhikiwfqnrrmkwkkee

SCOPe Domain Coordinates for d2h1kb_:

Click to download the PDB-style file with coordinates for d2h1kb_.
(The format of our PDB-style files is described here.)

Timeline for d2h1kb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2h1ka_