Lineage for d1eexm_ (1eex M:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353350Fold a.23: Open three-helical up-and-down bundle [47143] (5 superfamilies)
    core: 3 helices; bundle, open
  4. 353358Superfamily a.23.2: Diol dehydratase, gamma subunit [47148] (1 family) (S)
    contains irregular N-terminal subdomain
  5. 353359Family a.23.2.1: Diol dehydratase, gamma subunit [47149] (1 protein)
  6. 353360Protein Diol dehydratase, gamma subunit [47150] (2 species)
  7. 353361Species Klebsiella oxytoca [TaxId:571] [47151] (7 PDB entries)
  8. 353363Domain d1eexm_: 1eex M: [16491]
    Other proteins in same PDB: d1eexa_, d1eexb_, d1eexe_, d1eexl_
    complexed with coy, k, pgo

Details for d1eexm_

PDB Entry: 1eex (more details), 1.7 Å

PDB Description: crystal structure of the diol dehydratase-adeninylpentylcobalamin complex from klebsiella oxytoca

SCOP Domain Sequences for d1eexm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eexm_ a.23.2.1 (M:) Diol dehydratase, gamma subunit {Klebsiella oxytoca}
sarvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakda
grdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafv
reaatlyverkklkgdd

SCOP Domain Coordinates for d1eexm_:

Click to download the PDB-style file with coordinates for d1eexm_.
(The format of our PDB-style files is described here.)

Timeline for d1eexm_: