Lineage for d1fpoa2 (1fpo A:77-171)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2194Fold a.23: Open three-helical up-and-down bundle [47143] (4 superfamilies)
  4. 2195Superfamily a.23.1: HSC20 (HSCB), C-terminal oligomerisation domain [47144] (1 family) (S)
  5. 2196Family a.23.1.1: HSC20 (HSCB), C-terminal oligomerisation domain [47145] (1 protein)
  6. 2197Protein HSC20 (HSCB), C-terminal oligomerisation domain [47146] (1 species)
  7. 2198Species Escherichia coli [TaxId:562] [47147] (1 PDB entry)
  8. 2199Domain d1fpoa2: 1fpo A:77-171 [16487]
    Other proteins in same PDB: d1fpoa1, d1fpob1, d1fpoc1

Details for d1fpoa2

PDB Entry: 1fpo (more details), 1.8 Å

PDB Description: hsc20 (hscb), a j-type co-chaperone from e. coli

SCOP Domain Sequences for d1fpoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fpoa2 a.23.1.1 (A:77-171) HSC20 (HSCB), C-terminal oligomerisation domain {Escherichia coli}
fdlaseqhtvrdtaflmeqlelreeldeieqakdearlesfikrvkkmfdtrhqlmveql
dnetwdaaadtcrklrfldklrssaeqleeklldf

SCOP Domain Coordinates for d1fpoa2:

Click to download the PDB-style file with coordinates for d1fpoa2.
(The format of our PDB-style files is described here.)

Timeline for d1fpoa2: