Lineage for d2gvnf_ (2gvn F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2911318Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
    consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
    Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
    Domain 2 has parallel beta-sheet of 4 strands, order 1234
  4. 2911319Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) (S)
  5. 2911320Family c.88.1.1: Glutaminase/Asparaginase [53775] (4 proteins)
    automatically mapped to Pfam PF00710
  6. 2911594Protein automated matches [190446] (8 species)
    not a true protein
  7. 2911628Species Pectobacterium atrosepticum [TaxId:29471] [187353] (2 PDB entries)
  8. 2911634Domain d2gvnf_: 2gvn F: [164859]
    automated match to d1hg0a_
    complexed with asp

Details for d2gvnf_

PDB Entry: 2gvn (more details), 1.9 Å

PDB Description: l-asparaginase from erwinia carotovora in complex with aspartic acid
PDB Compounds: (F:) L-asparaginase

SCOPe Domain Sequences for d2gvnf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gvnf_ c.88.1.1 (F:) automated matches {Pectobacterium atrosepticum [TaxId: 29471]}
nlpnivilatggtiagsaaantqttgykagalgvetliqavpelktlanikgeqvasigs
enmtsdvlltlskrvnellarsdvdgvvithgtdtldespyflnltvksdkpvvfvaamr
pataisadgpmnlygavkvaadknsrgrgvlvvlndrigsarfisktnastldtfkapee
gylgviigdkiyyqtrldkvhttrsvfdvtnvdklpavdiiygyqddpeymydasikhgv
kgivyagmgagsvskrgdagirkaeskgivvvrssrtgsgivppdagqpglvadslspak
srillmlaltkttnpaviqdyfhay

SCOPe Domain Coordinates for d2gvnf_:

Click to download the PDB-style file with coordinates for d2gvnf_.
(The format of our PDB-style files is described here.)

Timeline for d2gvnf_: