Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.0: automated matches [191411] (1 protein) not a true family |
Protein automated matches [190563] (6 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187760] (1 PDB entry) |
Domain d2goic_: 2goi C: [164783] automated match to d1lsga1 |
PDB Entry: 2goi (more details), 2.3 Å
SCOPe Domain Sequences for d2goic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2goic_ d.2.1.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} akvfsrcelakemhdfgldgyrgynladwvclayytsgfntnavdheadgstnngifqis srrwcrtlasngpnlcriyctdllnndlkdsivcamkivqeplglgyweawrhhcqgrdl sdwvdgcd
Timeline for d2goic_: