Lineage for d2goib_ (2goi B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1013435Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1013436Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1014821Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 1014822Protein automated matches [190563] (6 species)
    not a true protein
  7. 1014828Species Mouse (Mus musculus) [TaxId:10090] [187760] (1 PDB entry)
  8. 1014830Domain d2goib_: 2goi B: [164782]
    automated match to d1lsga1

Details for d2goib_

PDB Entry: 2goi (more details), 2.3 Å

PDB Description: crystal structure of mouse sperm c-type lysozyme-like protein 1
PDB Compounds: (B:) sperm lysozyme-like protein 1

SCOPe Domain Sequences for d2goib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2goib_ d.2.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
akvfsrcelakemhdfgldgyrgynladwvclayytsgfntnavdheadgstnngifqis
srrwcrtlasngpnlcriyctdllnndlkdsivcamkivqeplglgyweawrhhcqgrdl
sdwvdgcd

SCOPe Domain Coordinates for d2goib_:

Click to download the PDB-style file with coordinates for d2goib_.
(The format of our PDB-style files is described here.)

Timeline for d2goib_: