SCOPe 2.08: Domain d2go2a1: 2go2 A:2-163

Lineage for d2go2a1 (2go2 A:2-163)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (3 families)

5. Family b.42.4.0: automated matches [191368] (1 protein)
   not a true family

6. Protein automated matches [190445] (12 species)
   not a true protein

7. Species Bauhinia bauhinioides [TaxId:166014] [187352] (3 PDB entries)

8. Domain d2go2a1: 2go2 A:2-163 [164780]
   Other proteins in same PDB: d2go2a2
   automated match to d1tiea_
   complexed with edo

Details for d2go2a1

PDB Entry: 2go2, 1.87 Å

PDB Description: Crystal structure of BbKI, a Kunitz-type kallikrein inhibitor

PDB Compounds: (A:) Kunitz-type serine protease inhibitor BbKI

SCOPe Domain Sequences for d2go2a1:

Sequence; same for both SEQRES and ATOM records:

>d2go2a1 b.42.4.0 (A:2-163) automated matches {Bauhinia bauhinioides [TaxId: 166014]}
svvvdtngqpvsngadayylvpvshghaglalakigneaepravvldphhrpglpvrfes
plriniikesyflnikfgpsssdsgvwdviqqdpiglavkvtdtksllgpfkvekegegy
kivyypergqtgldiglvhrndkyylavkdgepcvfkirkat

Timeline for d2go2a1:

• d2go2a1 first appeared in SCOPe 2.01, called d2go2a_
  
• d2go2a1 appears in SCOPe 2.07