SCOPe 2.06: Domain d2gnwb_: 2gnw B:

Lineage for d2gnwb_ (2gnw B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Non-symbiotic plant hemoglobin [46484] (1 species)

7. Species Rice (Oryza sativa) [TaxId:4530] [46485] (3 PDB entries)

8. Domain d2gnwb_: 2gnw B: [164779]
   automated match to d1d8ua_
   complexed with hem; mutant

Details for d2gnwb_

PDB Entry: 2gnw, 2.4 Å

PDB Description: crystal structure of non-symbiotic plant hemoglobin from rice, b10 mutant f40w

PDB Compounds: (B:) Non-symbiotic hemoglobin 1

SCOPe Domain Sequences for d2gnwb_:

Sequence; same for both SEQRES and ATOM records:

>d2gnwb_ a.1.1.2 (B:) Non-symbiotic plant hemoglobin {Rice (Oryza sativa) [TaxId: 4530]}
alvednnavavsfseeqealvlkswailkkdsanialrfwlkifevapsasqmfsflrns
dvpleknpklkthamsvfvmtceaaaqlrkagkvtvrdttlkrlgathlkygvgdahfev
vkfalldtikeevpadmwspamksawseaydhlvaaikqemkpae

Timeline for d2gnwb_:

• d2gnwb_ first appeared in SCOPe 2.01
  
• d2gnwb_ appears in SCOPe 2.05
  
• d2gnwb_ appears in SCOPe 2.07
  
• d2gnwb_ appears in the current release, SCOPe 2.08