SCOPe 2.07: Domain d2gnva_: 2gnv A:

Lineage for d2gnva_ (2gnv A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Non-symbiotic plant hemoglobin [46484] (1 species)

7. Species Rice (Oryza sativa) [TaxId:4530] [46485] (3 PDB entries)

8. Domain d2gnva_: 2gnv A: [164776]
   automated match to d1d8ua_
   complexed with dio, hem; mutant

Details for d2gnva_

PDB Entry: 2gnv, 2.3 Å

PDB Description: crystal structure of non-symbiotic plant hemoglobin from rice, b10 mutant f40l

PDB Compounds: (A:) Non-symbiotic hemoglobin 1

SCOPe Domain Sequences for d2gnva_:

Sequence; same for both SEQRES and ATOM records:

>d2gnva_ a.1.1.2 (A:) Non-symbiotic plant hemoglobin {Rice (Oryza sativa) [TaxId: 4530]}
avavsfseeqealvlkswailkkdsanialrfllkifevapsasqmfsflrnsdvplekn
pklkthamsvfvmtceaaaqlrkagkvtvrdttlkrlgathlkygvgdahfevvkfalld
tikeevpadmwspamksawseaydhlvaaikqemkpae

Timeline for d2gnva_:

• d2gnva_ first appeared in SCOPe 2.01
  
• d2gnva_ appears in SCOPe 2.06
  
• d2gnva_ appears in the current release, SCOPe 2.08