SCOPe 2.02: Domain d2gnfa_: 2gnf A:

Lineage for d2gnfa_ (2gnf A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein cAMP-dependent PK, catalytic subunit [56116] (4 species)
   AGC group; PKA subfamily; serine/threonine kinase

7. Species Cow (Bos taurus) [TaxId:9913] [56118] (39 PDB entries)
   Uniprot P00517

8. Domain d2gnfa_: 2gnf A: [164770]
   automated match to d1cmke_
   complexed with y27; mutant

Details for d2gnfa_

PDB Entry: 2gnf, 2.28 Å

PDB Description: protein kinase a fivefold mutant model of rho-kinase with y-27632

PDB Compounds: (A:) cAMP-dependent protein kinase, alpha-catalytic subunit

SCOPe Domain Sequences for d2gnfa_:

Sequence; same for both SEQRES and ATOM records:

>d2gnfa_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Cow (Bos taurus) [TaxId: 9913]}
seqesvkeflakakedflkkwenpaqntahldqferiktigtgsfgrvmlvkhmetgnhy
amkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeympggdmf
shlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyikvadfgfak
rvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyek
ivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrk
veapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

Timeline for d2gnfa_:

• d2gnfa_ first appeared in SCOPe 2.01
  
• d2gnfa_ appears in SCOPe 2.03
  
• d2gnfa_ appears in the current release, SCOPe 2.08