Lineage for d2gn1a1 (2gn1 A:2-325)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907817Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2907818Protein automated matches [190215] (38 species)
    not a true protein
  7. 2907991Species Salmonella typhimurium [TaxId:90371] [187759] (13 PDB entries)
  8. 2908008Domain d2gn1a1: 2gn1 A:2-325 [164767]
    Other proteins in same PDB: d2gn1a2
    automated match to d1v71a1
    complexed with na

Details for d2gn1a1

PDB Entry: 2gn1 (more details), 2.2 Å

PDB Description: Crystal structure of dimeric biodegradative threonine deaminase (TdcB) from Salmonella typhimurium at 2.2A resolution (Triclinic form with one dimer of TdcB in the asymmetric unit)
PDB Compounds: (A:) Threonine dehydratase catabolic

SCOPe Domain Sequences for d2gn1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gn1a1 c.79.1.0 (A:2-325) automated matches {Salmonella typhimurium [TaxId: 90371]}
hitydlpvaiedileakkrlagkiyktgmprsnyfserckgeiflkfenmqrtgsfkirg
afnklsslteaekrkgvvacsagnhaqgvslscamlgidgkvvmpkgapkskvaatcdys
aevvlhgdnfndtiakvseivetegrifippyddpkviagqgtigleimedlydvdnviv
piggggliagiaiaiksinptikvigvqaenvhgmaasyytgeitthrttgtladgcdvs
rpgnltyeivrelvddivlvsedeirnsmialiqrnkvitegagalacaallsgkldshi
qnrktvsiisggnidlsrvsqitg

SCOPe Domain Coordinates for d2gn1a1:

Click to download the PDB-style file with coordinates for d2gn1a1.
(The format of our PDB-style files is described here.)

Timeline for d2gn1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gn1a2
View in 3D
Domains from other chains:
(mouse over for more information)
d2gn1b_