![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins) lack the first helix (A) |
![]() | Protein Protozoan/bacterial hemoglobin [46460] (6 species) |
![]() | Species Mycobacterium tuberculosis, HbN [TaxId:1773] [63437] (8 PDB entries) Uniprot Q10784 |
![]() | Domain d2glna_: 2gln A: [164760] automated match to d1s56b_ complexed with cyn, hem, na, po4; mutant |
PDB Entry: 2gln (more details), 1.98 Å
SCOPe Domain Sequences for d2glna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2glna_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]} gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkavef faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap lavdvtsg
Timeline for d2glna_: