SCOPe 2.01: Domain d2glna_: 2gln A:

Lineage for d2glna_ (2gln A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
   lack the first helix (A)

6. Protein Protozoan/bacterial hemoglobin [46460] (6 species)

7. Species Mycobacterium tuberculosis, HbN [TaxId:1773] [63437] (8 PDB entries)
   Uniprot Q10784

8. Domain d2glna_: 2gln A: [164760]
   automated match to d1s56b_
   complexed with cyn, hem, na, po4; mutant

Details for d2glna_

PDB Entry: 2gln, 1.98 Å

PDB Description: crystal structure of mycobacterium tuberculosis trhbn, glne11ala mutant

PDB Compounds: (A:) Hemoglobin-like protein HbN

SCOPe Domain Sequences for d2glna_:

Sequence; same for both SEQRES and ATOM records:

>d2glna_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]}
gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkavef
faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
lavdvtsg

Timeline for d2glna_:

• d2glna_ is new in SCOPe 2.01-stable
  
• d2glna_ appears in SCOPe 2.02
  
• d2glna_ appears in the current release, SCOPe 2.08