SCOPe 2.08: Domain d2gffb1: 2gff B:1-96

Lineage for d2gffb1 (2gff B:1-96)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (33 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [187749] (1 PDB entry)

8. Domain d2gffb1: 2gff B:1-96 [164681]
   Other proteins in same PDB: d2gffa2, d2gffb2
   automated match to d2omoa1
   complexed with cl

Details for d2gffb1

PDB Entry: 2gff, 1.75 Å

PDB Description: crystal structure of yersinia pestis lsrg

PDB Compounds: (B:) LsrG Protein

SCOPe Domain Sequences for d2gffb1:

Sequence; same for both SEQRES and ATOM records:

>d2gffb1 d.58.4.0 (B:1-96) automated matches {Yersinia pestis [TaxId: 632]}
mhvtlveinvkedkvdqfievfranhlgsireagnlrfdvlrdehiptrfyiyeaytdea
avaihkttphylqcveqlaplmtgprkktvfiglmp

Timeline for d2gffb1:

• d2gffb1 first appeared in SCOPe 2.01, called d2gffb_
  
• d2gffb1 appears in SCOPe 2.07