Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
Protein automated matches [190081] (33 species) not a true protein |
Species Yersinia pestis [TaxId:632] [187749] (1 PDB entry) |
Domain d2gffb1: 2gff B:1-96 [164681] Other proteins in same PDB: d2gffa2, d2gffb2 automated match to d2omoa1 complexed with cl |
PDB Entry: 2gff (more details), 1.75 Å
SCOPe Domain Sequences for d2gffb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gffb1 d.58.4.0 (B:1-96) automated matches {Yersinia pestis [TaxId: 632]} mhvtlveinvkedkvdqfievfranhlgsireagnlrfdvlrdehiptrfyiyeaytdea avaihkttphylqcveqlaplmtgprkktvfiglmp
Timeline for d2gffb1: