Lineage for d2geua_ (2geu A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 990511Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 990512Protein automated matches [190123] (20 species)
    not a true protein
  7. 990595Species Mycobacterium tuberculosis [TaxId:83332] [187746] (10 PDB entries)
  8. 990605Domain d2geua_: 2geu A: [164674]
    automated match to d1esma_
    complexed with cok

Details for d2geua_

PDB Entry: 2geu (more details), 2.9 Å

PDB Description: pantothenate kinase from mycobacterium tuberculosis (mtpank) in complex with a coenzyme a derivative, form-ii (rt)
PDB Compounds: (A:) pantothenate kinase

SCOPe Domain Sequences for d2geua_:

Sequence, based on SEQRES records: (download)

>d2geua_ c.37.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
sepspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarlihlqv
aarqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhhprvd
lvttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshlhydi
ipgaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrflamrt
tafadpeshfhhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkdadhsi
nrlrlrkl

Sequence, based on observed residues (ATOM records): (download)

>d2geua_ c.37.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
sepspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarlihlqv
aarqrlfaataeflgeppdrpvpfiigvagsvavgksttarvlqallarwdhhprvdlvt
tdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshlhydiipg
aeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrflamrttaf
adpeshfhhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkdadhsinrl
rlrkl

SCOPe Domain Coordinates for d2geua_:

Click to download the PDB-style file with coordinates for d2geua_.
(The format of our PDB-style files is described here.)

Timeline for d2geua_: