SCOPe 2.01: Domain d2geta_: 2get A:

Lineage for d2geta_ (2get A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (20 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [187746] (10 PDB entries)

8. Domain d2geta_: 2get A: [164673]
   automated match to d1esma_
   complexed with cok, gol

Details for d2geta_

PDB Entry: 2get, 2.35 Å

PDB Description: pantothenate kinase from mycobacterium tuberculosis (mtpank) in complex with a coenzyme a derivative, form-i (lt)

PDB Compounds: (A:) pantothenate kinase

SCOPe Domain Sequences for d2geta_:

Sequence; same for both SEQRES and ATOM records:

>d2geta_ c.37.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
sepspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarlihlqv
aarqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhhprvd
lvttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshlhydi
ipgaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrflamrt
tafadpeshfhhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkdadhsi
nrlrlrkl

Timeline for d2geta_:

• d2geta_ is new in SCOPe 2.01-stable
  
• d2geta_ appears in SCOPe 2.02
  
• d2geta_ appears in the current release, SCOPe 2.08