Lineage for d2gdfb_ (2gdf B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778888Protein automated matches [190035] (28 species)
    not a true protein
  7. 2779036Species Dioclea violacea [TaxId:192415] [187744] (2 PDB entries)
  8. 2779038Domain d2gdfb_: 2gdf B: [164666]
    automated match to d1dgla_
    complexed with ca, mn

Details for d2gdfb_

PDB Entry: 2gdf (more details), 2.4 Å

PDB Description: Crystal structure of Dioclea violacea seed lectin
PDB Compounds: (B:) lectin

SCOPe Domain Sequences for d2gdfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gdfb_ b.29.1.1 (B:) automated matches {Dioclea violacea [TaxId: 192415]}
adtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr
lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsa
adenslhfsfhkfsqnpkdlilqgdaftdsdgnleltkvsssgdpqgnsvgralfyapvh
iweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan

SCOPe Domain Coordinates for d2gdfb_:

Click to download the PDB-style file with coordinates for d2gdfb_.
(The format of our PDB-style files is described here.)

Timeline for d2gdfb_: