Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
Protein automated matches [190205] (13 species) not a true protein |
Species Sphingobium yanoikuyae [TaxId:13690] [187741] (2 PDB entries) |
Domain d2gbwd_: 2gbw D: [164659] Other proteins in same PDB: d2gbwa1, d2gbwa2, d2gbwc1, d2gbwc2, d2gbwe1, d2gbwe2 automated match to d1ulid_ complexed with fe, fes, oxy |
PDB Entry: 2gbw (more details), 1.7 Å
SCOPe Domain Sequences for d2gbwd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gbwd_ d.17.4.0 (D:) automated matches {Sphingobium yanoikuyae [TaxId: 13690]} qipvtpdvhydieahyraevrmfqtgqyrewlqgmvaedihywmpiyeqrltrdrrpdpt pddaaiynddfgelkqrverlysgqvwmedppskiryfvsnveafeagngeldvlsnilv yrnrrqtevtvhtlgredklrrdgngfkvfrrklildarvtqdknlyffc
Timeline for d2gbwd_: