Lineage for d2gbvh_ (2gbv H:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1522748Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 1522749Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 1522762Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 1522864Species Human (Homo sapiens) [TaxId:9606] [49333] (71 PDB entries)
  8. 1522988Domain d2gbvh_: 2gbv H: [164655]
    automated match to d1l3na_
    complexed with cu1, zn

Details for d2gbvh_

PDB Entry: 2gbv (more details), 2 Å

PDB Description: c6a/c111a/c57a/c146a holo cuzn superoxide dismutase
PDB Compounds: (H:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d2gbvh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gbvh_ b.1.8.1 (H:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhaiigrtlvvh
ekaddlgkggneestktgnagsrlaagvigiaq

SCOPe Domain Coordinates for d2gbvh_:

Click to download the PDB-style file with coordinates for d2gbvh_.
(The format of our PDB-style files is described here.)

Timeline for d2gbvh_: