SCOPe 2.05: Domain d2gbkb_: 2gbk B:

Lineage for d2gbkb_ (2gbk B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189560] (79 PDB entries)

8. Domain d2gbkb_: 2gbk B: [164629]
   automated match to d1aara_
   mutant

Details for d2gbkb_

PDB Entry: 2gbk, 1.99 Å

PDB Description: crystal structure of the 9-10 moad insertion mutant of ubiquitin

PDB Compounds: (B:) Ubiquitin

SCOPe Domain Sequences for d2gbkb_:

Sequence; same for both SEQRES and ATOM records:

>d2gbkb_ d.15.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltqvrelvggktitlevepsdtienvkakiqdkegippdqqrlifagkqledg
rtlsdyniqkestlhlvlrlrg

Timeline for d2gbkb_:

• d2gbkb_ first appeared in SCOPe 2.01
  
• d2gbkb_ appears in SCOPe 2.04
  
• d2gbkb_ appears in SCOPe 2.06
  
• d2gbkb_ appears in the current release, SCOPe 2.08