Lineage for d2gasb_ (2gas B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842913Protein automated matches [190085] (59 species)
    not a true protein
  7. 2842971Species Alfalfa (Medicago sativa) [TaxId:3879] [187740] (1 PDB entry)
  8. 2842973Domain d2gasb_: 2gas B: [164623]
    automated match to d1qyca_

Details for d2gasb_

PDB Entry: 2gas (more details), 1.6 Å

PDB Description: Crystal Structure of Isoflavone Reductase
PDB Compounds: (B:) isoflavone reductase

SCOPe Domain Sequences for d2gasb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gasb_ c.2.1.2 (B:) automated matches {Alfalfa (Medicago sativa) [TaxId: 3879]}
tenkililgptgaigrhivwasikagnptyalvrktitaanpetkeelidnyqslgvill
egdindhetlvkaikqvdivicaagrlliedqvkiikaikeagnvkkffpsefgldvdrh
davepvrqvfeekasirrvieaegvpytylcchaftgyflrnlaqldatdpprdkvvilg
dgnvkgayvteadvgtftiraandpntlnkavhirlpknyltqnevialwekkigktlek
tyvseeqvlkdiqessfphnyllalyhsqqikgdavyeidpakdieaseaypdvtyttad
eylnqfv

SCOPe Domain Coordinates for d2gasb_:

Click to download the PDB-style file with coordinates for d2gasb_.
(The format of our PDB-style files is described here.)

Timeline for d2gasb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2gasa_