Class a: All alpha proteins [46456] (286 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
Protein automated matches [190590] (18 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187733] (2 PDB entries) |
Domain d2g3ha_: 2g3h A: [164573] automated match to d1ecaa_ complexed with cl, cyn, hem, mg |
PDB Entry: 2g3h (more details), 1.4 Å
SCOPe Domain Sequences for d2g3ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g3ha_ a.1.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} mnsdevqlikktweipvatptdsgaailtqffnrfpsnlekfpfrdvpleelsgnarfra hagriirvfdesiqvlgqdgdlekldeiwtkiavshiprtvskesynqlkgvildvltaa ssldesqaatwaklvdhvygiifkaidddgnak
Timeline for d2g3ha_: