SCOPe 2.05: Domain d2g3ha_: 2g3h A:

Lineage for d2g3ha_ (2g3h A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (18 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187733] (2 PDB entries)

8. Domain d2g3ha_: 2g3h A: [164573]
   automated match to d1ecaa_
   complexed with cl, cyn, hem, mg

Details for d2g3ha_

PDB Entry: 2g3h, 1.4 Å

PDB Description: cyanide binding and heme cavity conformational transitions in drosophila melanogaster hexa-coordinate hemoglobin

PDB Compounds: (A:) globin

SCOPe Domain Sequences for d2g3ha_:

Sequence; same for both SEQRES and ATOM records:

>d2g3ha_ a.1.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mnsdevqlikktweipvatptdsgaailtqffnrfpsnlekfpfrdvpleelsgnarfra
hagriirvfdesiqvlgqdgdlekldeiwtkiavshiprtvskesynqlkgvildvltaa
ssldesqaatwaklvdhvygiifkaidddgnak

Timeline for d2g3ha_:

• d2g3ha_ first appeared in SCOPe 2.01
  
• d2g3ha_ appears in SCOPe 2.04
  
• d2g3ha_ appears in SCOPe 2.06
  
• d2g3ha_ appears in the current release, SCOPe 2.08