![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
![]() | Protein automated matches [190144] (14 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [187707] (14 PDB entries) |
![]() | Domain d2fhh2_: 2fhh 2: [164362] automated match to d1q5qh_ complexed with m1n |
PDB Entry: 2fhh (more details), 2.99 Å
SCOPe Domain Sequences for d2fhh2_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fhh2_ d.153.1.4 (2:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
Timeline for d2fhh2_:
![]() Domains from other chains: (mouse over for more information) d2fhh1_, d2fhha_, d2fhhb_, d2fhhc_, d2fhhd_, d2fhhe_, d2fhhf_, d2fhhg_, d2fhhh_, d2fhhi_, d2fhhj_, d2fhhk_, d2fhhl_, d2fhhm_, d2fhhn_, d2fhho_, d2fhhp_, d2fhhq_, d2fhhr_, d2fhhs_, d2fhht_, d2fhhu_, d2fhhv_, d2fhhw_, d2fhhx_, d2fhhy_, d2fhhz_ |