Lineage for d2fg8d_ (2fg8 D:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1264121Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1264122Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1264123Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1264124Protein (Apo)ferritin [47246] (8 species)
  7. 1264221Species Human (Homo sapiens) [TaxId:9606] [187702] (7 PDB entries)
  8. 1264228Domain d2fg8d_: 2fg8 D: [164348]
    automated match to d1data_
    complexed with cs

Details for d2fg8d_

PDB Entry: 2fg8 (more details), 2.5 Å

PDB Description: Structure of Human Ferritin L Chain
PDB Compounds: (D:) ferritin light chain

SCOPe Domain Sequences for d2fg8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fg8d_ a.25.1.1 (D:) (Apo)ferritin {Human (Homo sapiens) [TaxId: 9606]}
ssqirqnystdveaavnslvnlylqasytylslgfyfdrddvalegvshffrelaeekre
gyerllkmqnqrggralfqdikkpaedewgktpdamkaamalekklnqalldlhalgsar
tdphlcdflethfldeevklikkmgdhltnlhrlggpeaglgeylferltlkhd

SCOPe Domain Coordinates for d2fg8d_:

Click to download the PDB-style file with coordinates for d2fg8d_.
(The format of our PDB-style files is described here.)

Timeline for d2fg8d_: