Lineage for d2fg8a_ (2fg8 A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1084172Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1084173Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1084174Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1084175Protein (Apo)ferritin [47246] (8 species)
  7. 1084262Species Human (Homo sapiens) [TaxId:9606] [187702] (3 PDB entries)
  8. 1084265Domain d2fg8a_: 2fg8 A: [164345]
    automated match to d1data_
    complexed with cs

Details for d2fg8a_

PDB Entry: 2fg8 (more details), 2.5 Å

PDB Description: Structure of Human Ferritin L Chain
PDB Compounds: (A:) ferritin light chain

SCOPe Domain Sequences for d2fg8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fg8a_ a.25.1.1 (A:) (Apo)ferritin {Human (Homo sapiens) [TaxId: 9606]}
ssqirqnystdveaavnslvnlylqasytylslgfyfdrddvalegvshffrelaeekre
gyerllkmqnqrggralfqdikkpaedewgktpdamkaamalekklnqalldlhalgsar
tdphlcdflethfldeevklikkmgdhltnlhrlggpeaglgeylferltlkhd

SCOPe Domain Coordinates for d2fg8a_:

Click to download the PDB-style file with coordinates for d2fg8a_.
(The format of our PDB-style files is described here.)

Timeline for d2fg8a_: