SCOPe 2.08: Domain d2feps_: 2fep S:

Lineage for d2feps_ (2fep S:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (2 families)

5. Family d.94.1.1: HPr-like [55595] (3 proteins)
   automatically mapped to Pfam PF00381

6. Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species)

7. Species Bacillus subtilis [TaxId:1423] [55597] (7 PDB entries)

8. Domain d2feps_: 2fep S: [164339]
   Other proteins in same PDB: d2fepa_
   automated match to d1kklj_
   complexed with so4

Details for d2feps_

PDB Entry: 2fep, 2.45 Å

PDB Description: Structure of truncated CcpA in complex with P-Ser-HPr and Sulfate ions

PDB Compounds: (S:) Phosphocarrier protein HPr

SCOPe Domain Sequences for d2feps_:

Sequence; same for both SEQRES and ATOM records:

>d2feps_ d.94.1.1 (S:) Histidine-containing phosphocarrier protein (HPr) {Bacillus subtilis [TaxId: 1423]}
aqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlksimgvmslgiakgaei
tisasgadendalnaleetmkseglge

Timeline for d2feps_:

• d2feps_ first appeared in SCOPe 2.01
  
• d2feps_ appears in SCOPe 2.07