SCOPe 2.01: Domain d2fbda_: 2fbd A:

Lineage for d2fbda_ (2fbd A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.0: automated matches [191411] (1 protein)
   not a true family

6. Protein automated matches [190563] (6 species)
   not a true protein

7. Species House fly (Musca domestica) [TaxId:7370] [187696] (2 PDB entries)

8. Domain d2fbda_: 2fbd A: [164320]
   automated match to d1gd6a_
   complexed with peg, so4

Details for d2fbda_

PDB Entry: 2fbd, 1.9 Å

PDB Description: the crystallographic structure of the digestive lysozyme 1 from musca domestica at 1.90 ang.

PDB Compounds: (A:) Lysozyme 1

SCOPe Domain Sequences for d2fbda_:

Sequence; same for both SEQRES and ATOM records:

>d2fbda_ d.2.1.0 (A:) automated matches {House fly (Musca domestica) [TaxId: 7370]}
ktftrcslaremyalgvpkselpqwtciaehessyrtnvvgptnsngsndygifqinnyy
wcqpsngrfsynechlscdalltdnisnsvtcarkiksqqgwtawstwkycsgslpsind
cf

Timeline for d2fbda_:

• d2fbda_ is new in SCOPe 2.01-stable
  
• d2fbda_ appears in SCOPe 2.02
  
• d2fbda_ appears in the current release, SCOPe 2.08