SCOPe 2.03: Domain d2f9nc_: 2f9n C:

Lineage for d2f9nc_ (2f9n C:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein automated matches [190044] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187233] (129 PDB entries)

8. Domain d2f9nc_: 2f9n C: [164295]
   automated match to d1ltoa_
   complexed with bu3, nag; mutant

Details for d2f9nc_

PDB Entry: 2f9n, 1.6 Å

PDB Description: crystal structure of the recombinant human alpha i tryptase mutant k192q/d216g in complex with leupeptin

PDB Compounds: (C:) alpha I tryptase

SCOPe Domain Sequences for d2f9nc_:

Sequence; same for both SEQRES and ATOM records:

>d2f9nc_ b.47.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggqeaprskwpwqvslrvrdrywmhfcggslihpqwvltaahcvgpdvkdlatlrvql
reqhlyyqdqllpvsriivhpqfyiiqtgadialleleepvnissrvhtvmlppasetfp
pgmpcwvtgwgdvdndeplpppfplkqvkvpimenhicdakyhlgaytgddvriirddml
cagnsqrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
vpk

Timeline for d2f9nc_:

• d2f9nc_ first appeared in SCOPe 2.01
  
• d2f9nc_ appears in SCOPe 2.02
  
• d2f9nc_ appears in SCOPe 2.04
  
• d2f9nc_ appears in the current release, SCOPe 2.08