| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) ![]() repeats organized in elongated structures |
| Family d.211.1.1: Ankyrin repeat [48404] (21 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
| Protein automated matches [190101] (7 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187689] (13 PDB entries) |
| Domain d2f8ya_: 2f8y A: [164284] automated match to d1ot8a_ complexed with so4 applies to all domains of a family if the common domain is composed of a different number of small repeating units |
PDB Entry: 2f8y (more details), 1.55 Å
SCOPe Domain Sequences for d2f8ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f8ya_ d.211.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avisdfiyqgaslhnqtdrtgetalhlaarysrsdaakrlleasadaniqdnmgrtplha
avsadaqgvfqilirnratdldarmhdgttplilaarlavegmledlinshadvnavddl
gksalhwaaavnnvdaavvllkngankdmqnnreetplflaaregsyetakvlldhfanr
ditdhmdrlprdiaqermhhdivrlldeynlvrsp
Timeline for d2f8ya_: