Lineage for d2f24a_ (2f24 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 959648Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 959649Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 959650Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 959827Protein automated matches [190279] (4 species)
    not a true protein
  7. 959828Species Human (Homo sapiens) [TaxId:9606] [187077] (11 PDB entries)
  8. 959831Domain d2f24a_: 2f24 A: [164253]
    automated match to d1vcua_
    complexed with cl; mutant

Details for d2f24a_

PDB Entry: 2f24 (more details), 1.76 Å

PDB Description: Crystal Structure of the Human Sialidase Neu2 E111Q Mutant
PDB Compounds: (A:) Sialidase 2

SCOPe Domain Sequences for d2f24a_:

Sequence, based on SEQRES records: (download)

>d2f24a_ b.68.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slpvlqkesvfqsgahayripallylpgqqsllafaeqraskkdehaelivlrrgdydap
thqvqwqaqevvaqarldghrsmnpcplydaqtgtlflffiaipgqvtqqqqlqtranvt
rlcqvtstdhgrtwssprdltdaaigpayrewstfavgpghclqlndrarslvvpayayr
klhpiqrpipsafcflshdhgrtwarghfvaqdtlecqvaevetgeqrvvtlnarshlra
rvqaqstndgldfqesqlvkklvepppqgcqgsvisfpsprsgpgspaqwllythpthsw
qradlgaylnprppapeawsepvllakgscaysdlqsmgtgpdgsplfgclyeandyeei
vflmftlkqafpaey

Sequence, based on observed residues (ATOM records): (download)

>d2f24a_ b.68.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slpvlqkesvfqsgahayripallylpgqqsllafaeqraaelivlrrgdydapthqvqw
qaqevvaqarldghrsmnpcplydaqtgtlflffiaipgqvtqqqqlqtranvtrlcqvt
stdhgrtwssprdltdaaigpayrewstfavgpghclqlndrarslvvpayayrklhpiq
rpipsafcflshdhgrtwarghfvaqdtlecqvaevqrvvtlnarshlrarvqaqstndg
ldfqesqlvkklvepppqgcqgsvisfpspraqwllythpthswqradlgaylnprppap
eawsepvllakgscaysdlqsmgtgpdgsplfgclyeandyeeivflmftlkqafpaey

SCOPe Domain Coordinates for d2f24a_:

Click to download the PDB-style file with coordinates for d2f24a_.
(The format of our PDB-style files is described here.)

Timeline for d2f24a_: