SCOPe 2.06: Domain d2f1ra1: 2f1r A:4-161

Lineage for d2f1ra1 (2f1r A:4-161)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [187684] (2 PDB entries)

8. Domain d2f1ra1: 2f1r A:4-161 [164251]
   Other proteins in same PDB: d2f1ra2, d2f1ra3, d2f1rb2
   automated match to d1np6a_
   complexed with cl, pr

Details for d2f1ra1

PDB Entry: 2f1r, 2.1 Å

PDB Description: crystal structure of molybdopterin-guanine biosynthesis protein b (mobb)

PDB Compounds: (A:) molybdopterin-guanine dinucleotide biosynthesis protein B (mobB)

SCOPe Domain Sequences for d2f1ra1:

Sequence, based on SEQRES records:

>d2f1ra1 c.37.1.0 (A:4-161) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
ilsivgtsdsgkttlitrmmpilrerglrvavvkrhahgdfeidkegkdswkiynsgadv
viaspvklafirrvseeegndldwiyerylsdydlvitegfskagkdrivvvkkpeeveh
frqgrilavvcdervdghkwfrrdeveriaefilsllr

Sequence, based on observed residues (ATOM records):

>d2f1ra1 c.37.1.0 (A:4-161) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
ilsivgtsdsgkttlitrmmpilrerglrvavvkrkdswkiynsgadvviaspvklafir
rvseeegndldwiyerylsdydlvitegfskagkdrivvvkkpeevehfrqgrilavvcd
ervdghkwfrrdeveriaefilsllr

Timeline for d2f1ra1:

• d2f1ra1 first appeared in SCOPe 2.01, called d2f1ra_
  
• d2f1ra1 was called d2f1ra_ in SCOPe 2.05
  
• d2f1ra1 appears in SCOPe 2.07
  
• d2f1ra1 appears in the current release, SCOPe 2.08