SCOPe 2.01: Domain d2ekzb_: 2ekz B:

Lineage for d2ekzb_ (2ekz B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families)

5. Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)

6. Protein automated matches [190196] (7 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [187129] (15 PDB entries)

8. Domain d2ekzb_: 2ekz B: [164148]
   automated match to d1v37a_

Details for d2ekzb_

PDB Entry: 2ekz, 1.85 Å

PDB Description: structural study of project id tthb049 from thermus thermophilus hb8 (l52m)

PDB Compounds: (B:) Alpha-ribazole-5'-phosphate phosphatase

SCOPe Domain Sequences for d2ekzb_:

Sequence; same for both SEQRES and ATOM records:

>d2ekzb_ c.60.1.1 (B:) automated matches {Thermus thermophilus [TaxId: 300852]}
melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdmlrarrtae
lagfsprlypelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrf
leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrlal

Timeline for d2ekzb_:

• d2ekzb_ is new in SCOPe 2.01-stable
  
• d2ekzb_ appears in SCOPe 2.02
  
• d2ekzb_ appears in the current release, SCOPe 2.08