Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (239 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [187989] (16 PDB entries) |
Domain d2ekqc_: 2ekq C: [164137] automated match to d1vl8a_ complexed with gol, so4 |
PDB Entry: 2ekq (more details), 1.8 Å
SCOPe Domain Sequences for d2ekqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ekqc_ c.2.1.0 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} erkalvtggsrgigraiaealvargyrvaiasrnpeeaaqslgavplptdlekddpkglv kralealgglhvlvhaaavnvrkpalelsyeewrrvlylhldvafllaqaaaphmaeagw grvlfigsvttftaggpvpipayttaktallgltralakewarlgirvnllcpgyvetef tlplrqnpelyepitaripmgrwarpeeiarvaavlcgdeaeyltgqavavdggflay
Timeline for d2ekqc_: