SCOPe 2.06: Domain d2ekqb_: 2ekq B:

Lineage for d2ekqb_ (2ekq B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [187989] (16 PDB entries)

8. Domain d2ekqb_: 2ekq B: [164136]
   automated match to d1vl8a_
   complexed with gol, so4

Details for d2ekqb_

PDB Entry: 2ekq, 1.8 Å

PDB Description: Structure of TT0495 protein from Thermus thermophilus

PDB Compounds: (B:) 2-deoxy-D-gluconate 3-dehydrogenase

SCOPe Domain Sequences for d2ekqb_:

Sequence; same for both SEQRES and ATOM records:

>d2ekqb_ c.2.1.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
erkalvtggsrgigraiaealvargyrvaiasrnpeeaaqslgavplptdlekddpkglv
kralealgglhvlvhaaavnvrkpalelsyeewrrvlylhldvafllaqaaaphmaeagw
grvlfigsvttftaggpvpipayttaktallgltralakewarlgirvnllcpgyvetef
tlplrqnpelyepitaripmgrwarpeeiarvaavlcgdeaeyltgqavavdggflay

Timeline for d2ekqb_:

• d2ekqb_ first appeared in SCOPe 2.01
  
• d2ekqb_ appears in SCOPe 2.05
  
• d2ekqb_ appears in SCOPe 2.07
  
• d2ekqb_ appears in the current release, SCOPe 2.08