SCOPe 2.06: Domain d2ek6d1: 2ek6 D:13-87

Lineage for d2ek6d1 (2ek6 D:13-87)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein automated matches [190332] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries)

8. Domain d2ek6d1: 2ek6 D:13-87 [164124]
   Other proteins in same PDB: d2ek6a2, d2ek6b2, d2ek6c2, d2ek6d2
   automated match to d2cqpa1

Details for d2ek6d1

PDB Entry: 2ek6, 2.38 Å

PDB Description: crystal structure of human rna-binding protein 12

PDB Compounds: (D:) RNA-binding protein 12

SCOPe Domain Sequences for d2ek6d1:

Sequence; same for both SEQRES and ATOM records:

>d2ek6d1 d.58.7.1 (D:13-87) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgeamvafesrdeataav
idlndrpigsrkvkl

Timeline for d2ek6d1:

• d2ek6d1 first appeared in SCOPe 2.01, called d2ek6d_
  
• d2ek6d1 was called d2ek6d_ in SCOPe 2.05
  
• d2ek6d1 appears in SCOPe 2.07
  
• d2ek6d1 appears in the current release, SCOPe 2.08