Lineage for d2ej0e_ (2ej0 E:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2248742Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 2248743Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 2248862Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 2248863Protein automated matches [190815] (13 species)
    not a true protein
  7. 2248920Species Thermus thermophilus HB8 [TaxId:300852] [188374] (4 PDB entries)
  8. 2248928Domain d2ej0e_: 2ej0 E: [164078]
    automated match to d1a3ga_
    complexed with mpd, pmp

Details for d2ej0e_

PDB Entry: 2ej0 (more details), 1.6 Å

PDB Description: Crystal Structure of T.th.HB8 Branched-Chain Amino Acid Aminotransferase with Pyridoxamine 5'-phosphate
PDB Compounds: (E:) branched-chain amino acid aminotransferase

SCOPe Domain Sequences for d2ej0e_:

Sequence, based on SEQRES records: (download)

>d2ej0e_ e.17.1.0 (E:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
qikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrfy
nsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevmv
aawewgaylgeeavrkgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagade
allldeegyvaegsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvrat
rdqlymadevfmtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyegw
ltyvn

Sequence, based on observed residues (ATOM records): (download)

>d2ej0e_ e.17.1.0 (E:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
qikagliwmngafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrfy
nsakvlrmeipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevmv
aawewgarlitsswarfpanvmpgkakvggnyvnsalakmeavaagadeallldeegyva
egsgenlffvrdgviyalehsvnlegitrdsviriakdlgyevqvvratrdqlymadevf
mtgtaaevtpvsmidwrpigkgtagpvalrlrevyleavtgrrpeyegwltyvn

SCOPe Domain Coordinates for d2ej0e_:

Click to download the PDB-style file with coordinates for d2ej0e_.
(The format of our PDB-style files is described here.)

Timeline for d2ej0e_: